If you have been reading about Quality control and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-04-10. Where a claim depends on a specific study, the study is described rather than over-claimed.
System suitability testing is performed before and during analytical runs to confirm that the instrument and method are working as expected. Common checks include retention time, peak area, resolution between critical pairs, tailing factor, and theoretical plate count. Results are compared with predefined limits, and a failed check requires investigation before sample results are reported. Quality control samples at low, middle, and high concentrations are injected at intervals to monitor accuracy and precision. Blank injections detect carryover and contamination, while control charts track performance over time.
Data handling and documentation are central to HPLC quality control. Electronic systems should have audit trails that record changes to methods, sequences, and results. Integration parameters, such as peak baseline and threshold, can affect reported areas and must be defined in advance. Out-of-specification results trigger a structured investigation that may include reanalysis, instrument checks, and review of sample preparation. Regulatory inspections often examine raw data, audit trails, and training records to verify that reported results are traceable and reliable.
Method validation establishes that an HPLC procedure is suitable for its intended use. Key parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Accuracy measures agreement with a true or accepted value, while precision describes repeatability and intermediate precision. Specificity confirms that the method measures the analyte without interference from impurities, degradants, or excipients. Validation is documented in a protocol and report, and acceptance criteria are set before experiments begin. Regulatory guidance varies by region, but the general principles are widely harmonized.
In quality control laboratories, HPLC testing supports batch release, raw material checks, stability studies, and impurity profiling. A validated method defines sample preparation, instrument settings, calibration, and acceptance criteria. Analysts compare results with specifications and investigate out-of-specification outcomes before a batch is approved. Documentation includes chromatograms, integration records, audit trails, and reagent details. Because results influence product decisions, laboratories follow formal quality systems and data integrity rules. The exact tests and limits depend on the material, its intended use, and the applicable regulatory framework.
Method validation examines whether an HPLC procedure is suitable for its intended purpose. Common parameters include accuracy, precision, specificity, linearity, range, detection limit, quantification limit, and robustness. Accuracy describes closeness to a true or accepted value, while precision describes agreement among repeated measurements. Specificity shows whether the method can measure the analyte without interference from related substances. Robustness tests small deliberate changes in flow, temperature, or solvent composition. Validation is not a one-time event; methods may need partial revalidation after changes to instruments, columns, sample handling, or specification limits. Regulatory guidance provides frameworks, but some details remain method-specific.
| Property | Value | Notes |
|---|---|---|
| Validation parameter | Accuracy | Measured value compared with true or accepted value |
| Precision type | Repeatability | Same analyst, instrument, and short time interval |
| Linearity range | 50–150% of target concentration | Common for assay methods; method-dependent |
| Limit of quantitation | Signal-to-noise ratio of 10:1 | Lowest concentration with acceptable precision |
| Common synonyms | Method validation, analytical validation | Documented confirmation that a method is suitable |
Validation demonstrates that a method is suitable for its intended use. Typical performance characteristics include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Regulators and standards organizations provide frameworks, but specific requirements depend on the application and jurisdiction. System suitability tests are run before sample analysis to confirm resolution, peak symmetry, retention time repeatability, and sensitivity. A validated method is not permanently fixed; changes may require partial or full revalidation.
Routine HPLC testing depends on controlled reagents, calibrated instruments, and documented procedures. Columns degrade over time, so retention times and peak shapes are monitored for drift. Mobile phases are filtered and degassed to prevent pump damage and detector noise. Reference standards must be traceable and stored under suitable conditions. Data handling systems record injections, calculations, and audit trails. Quality control samples interspersed with unknowns help detect errors during a run.
Developing an HPLC method begins with defining the purpose, such as quantifying a main component, measuring impurities, or confirming identity. Analysts select separation mode, column, mobile phase, detection, and sample preparation based on analyte properties and matrix. Experiments vary solvent strength, pH, buffer type, and temperature to achieve resolution between critical peaks. The goal is a robust method that produces reliable results across instruments and operators. Method development often involves trial runs and statistical optimization.
Routine quality control includes blanks, duplicates, spiked samples, and certified reference materials. Calibration curves are prepared with standards at several concentrations, and the detector response is checked for linearity. Carryover, column aging, mobile phase evaporation, and temperature drift can shift retention times or peak areas. Maintenance such as replacing seals, filters, and columns helps prevent failures. Records of injections, integration, and deviations support traceability. Audits may request raw data and instrument logs for each batch.
Developing an HPLC test begins with defining the analytes, matrix, and required reporting limits. Chemists select a separation mode, column chemistry, mobile phase composition, flow rate, and detection wavelength or mass transition. Experiments then adjust these variables to achieve adequate retention, resolution, and peak shape. System suitability tests confirm that the instrument and method perform consistently before sample analysis. Without suitable resolution, quantitative results may be unreliable. Preliminary runs often use scouting gradients to locate retention windows.
Validation establishes that a method is suitable for its intended purpose. Typical parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantification, robustness, and stability of standards and samples. Acceptance criteria are defined in advance, and results are documented in a validation report. Regulatory guidance for pharmaceuticals, foods, and environmental testing differs, so the applicable framework must be identified. Ongoing verification uses control samples and trend charts after validation. Method transfer to another laboratory may require partial revalidation.
Quality control samples are inserted at intervals to monitor accuracy and precision throughout a batch. Blank samples detect contamination, while spiked samples assess recovery from the sample matrix. Calibration standards establish the relationship between detector response and concentration, and control samples are prepared independently from them whenever possible. Laboratories also participate in proficiency testing and maintain audit trails, instrument logs, and reagent records. Ongoing review of control charts can reveal trends before they cause out-of-specification results.
Method validation demonstrates that an HPLC procedure is suitable for its intended purpose. Common validation parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantification, and robustness. Accuracy reflects agreement with a reference value, while precision describes repeatability under defined conditions. Specificity shows whether the method can measure the analyte in the presence of impurities or matrix components. Validation documents are reviewed before a method is used for routine testing or regulatory submissions.
Routine quality control monitors retention time shifts, baseline noise, system pressure, and peak shape. Trends can reveal column aging, mobile phase preparation errors, detector drift, or sample degradation. Corrective actions may include replacing the column, preparing fresh mobile phase, or recalibrating the detector. Stability testing often uses HPLC to measure parent compound loss and degradation product formation. Open questions remain about how accelerated stability results extrapolate to long-term storage under varied conditions.
Quality control for HPLC testing combines scheduled checks, documented procedures, and review of results. Before sample analysis, system suitability testing confirms that the instrument, column, and method meet predefined criteria. Common criteria include resolution between critical peaks, retention time precision, peak tailing, and theoretical plate count. Failure triggers investigation before results are reported. Records link raw data, calculations, instrument logs, and analyst identity to each batch, supporting audits and repeat analysis.
Method validation evaluates accuracy, precision, specificity, linearity, range, detection limit, quantitation limit, and robustness. Regulatory guidance for pharmaceuticals, foods, and environmental testing defines expected documentation and acceptance criteria. Verification confirms that a validated method works in a specific laboratory with its own instruments and reagents. Calibration curves use reference standards with known purity and traceability, while measurement uncertainty is estimated from validation data, control charts, and collaborative studies. The scope of validation depends on the method's intended use.
While it is usually considered that the driver has the responsibility when collisions occur, vehicle can also contribute to collisions, up to 3% to 5% of crashes. Two kinds of programs exist: new car assessment program for new cars, and vehicle inspections for other ones. A New Car Assessment Program is a government or institutional car safety program tasked with evaluating new car designs for performance against various safety threats. Two well known NCAP are United States New Car Assessment Program since 1978 and European New Car Assessment Programme since 1997.
Homopolymers of amino acids (such as polylysine) can adopt α-helical structure at low temperature that is "melted out" at high temperatures. This helix–coil transition was once thought to be analogous to protein denaturation. The statistical mechanics of this transition can be modeled using an elegant transfer matrix method, characterized by two parameters: the propensity to initiate a helix and the propensity to extend a helix.
A major focus in the field of protein engineering is on creating DNA libraries that sample regions of sequence space, often with the goal of finding mutants of proteins with enhanced functions compared to the wild type. These libraries are created either by using a wild type sequence as a template and applying one or more mutagenesis techniques to make different variants of it, or by creating proteins from scratch using artificial gene synthesis. These libraries are then screened or selected, and ones with improved phenotypes are used for the next round of mutagenesis. Protein Sequence space Directed evolution Protein engineering High-dimensional space
Sources: en.wikipedia.org
In physics and chemistry, binding energy is the smallest amount of energy required to remove a particle from a system of particles or to disassemble a system of particles into individual parts. In the former meaning the term is predominantly used in condensed matter physics, atomic physics, and chemistry, whereas in nuclear physics the term separation energy is used. A bound system is typically at a lower energy level than its unbound constituents. According to relativity theory, a ΔE decrease in the total energy of a system is accompanied by a decrease Δm in the total mass, where Δmc2 = ΔE. There are several types of binding energy, each operating over a different distance and energy scale. The smaller the size of a bound system, the higher its associated binding energy.
Aspartic acid was first discovered in 1827 by Auguste-Arthur Plisson and Étienne-Ossian Henry by hydrolysis of asparagine, which had been isolated from asparagus juice in 1806. Their original method used lead hydroxide, but various other acids or bases are now more commonly used instead. There are two forms or enantiomers of aspartic acid. The name "aspartic acid" can refer to either enantiomer or a mixture of two. Of these two forms, only one, "L-aspartic acid", is directly incorporated into proteins. The biological roles of its counterpart, "D-aspartic acid" are more limited. Where enzymatic synthesis will produce one or the other, most chemical syntheses will produce both forms, "DL-aspartic acid", known as a racemic mixture. In the human body, aspartate is most frequently synthesized through the transamination of oxaloacetate. The biosynthesis of aspartate is facilitated by an aminotransferase enzyme: the transfer of an amine group from another molecule such as alanine or glutamine yields aspartate and an alpha-keto acid.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
A skeletal survey is useful to confirm the diagnosis of achondroplasia. The skull is large, with a narrow foramen magnum, and relatively small skull base. The vertebral bodies are short and flattened with relatively large intervertebral disk height, and there is congenitally narrowed spinal canal. The iliac wings are small and squared, with a narrow sciatic notch and horizontal acetabular roof. The tubular bones are short and thick with metaphyseal cupping and flaring and irregular growth plates. Fibular overgrowth is present. The hand is broad with short metacarpals and phalanges, and a trident configuration. The ribs are short with cupped anterior ends. If the radiographic features are not classic, a search for a different diagnosis should be entertained. Because of the extremely deformed bone structure, people with achondroplasia are often "double jointed". The diagnosis can be made by fetal ultrasound by progressive discordance between the short femur length and biparietal diameter by age. The trident hand configuration can be seen if the fingers are fully extended. Another common characteristic of the syndrome is thoracolumbar gibbus in infancy.
Sources: en.wikipedia.org
Absorbance Units Full Scale (AUFS) or Absorption Units Full Scale is a unit of absorbance intensity that denotes the output of a spectrophotometer. The acronym AUFS can also be written out as Absorbance Units per Full Scale Deflection. AUFS is an arbitrary unit of the maximum ultraviolet or visible light absorbance intensity measured by a detector. It can be used in chemical analysis to quantify components in a mixture, as each component's integrated peak area corresponds to their relative abundance. AUFS is given as a number ranging from 0 to 1, where a measurement of 1 AUFS indicates an absorbance reading of 1 at full deflection. Analytical chemistry Chromatography Spectroscopy
The structure of CARD11 involves multiple domains that impact the protein's ability to activate BCL10 and NF-κB activity. CARD11 has a CARD domain, a serine-threonine rich region, is associated with the N-terminus, which is essential for NF-κB signaling activity. The region following the CARD domain is highly coiled. In deleting the CARD domain, all NF-κB signaling activity was prevented. The CARD domain on CARD11 interacts with the CARD domain on BCL10 to initiate the signaling pathway. On the C-terminus of CARD11 there is the MAGUK domain that is associated with the cell membrane. This domain is often referred to as the inhibitory domain. Protein kinase C activates CARD11 by phosphorylating serine residues within the inhibitory domain. CARD11 has been shown to interact with BCL10. This interaction occurs between the CARD domain on BCL10 and the CARD domain on CARD11, and results in signal propagation and NF-κB activation. Human CARD11 genome location and CARD11 gene details page in the UCSC Genome Browser.
Sulfide oxidation is performed by both bacteria and archaea in a variety of environmental conditions. Aerobic sulfide oxidation is usually performed by autotrophs that use sulfide or elemental sulfur to fix carbon dioxide. The oxidation pathway includes the formation of various intermediate sulfur species, including elemental sulfur and thiosulfate. Under low oxygen concentrations, microbes will oxidize to elemental sulfur. This elemental sulfur accumulates as sulfur globules, intracellularly or extracellularly, to be consumed under low sulfur concentrations. To ameliorate low oxidant concentrations (that is, to find an electron sink), sulfur oxidizers like cable bacteria form long chains that span the length between oxic and sulfidic zones of the coastal sediments. The bacteria present in the sulfide rich zones oxidize the sulfide and transport the electrons to the bacteria present in the oxygen rich zone through multiple periplasmic strings where the oxygen is reduced.
Adenylyl cyclase: When a ligand binds to the ADRB-1 receptor, the alpha-subunit of the heterotrimeric G-protein gets activated, which in turn, activates the enzyme adenylyl cyclase. Adenylyl cyclase then catalyzes the conversion of ATP to cyclic AMP (cAMP), which activates downstream effectors such as Protein Kinase A (PKA). cAMP activation of PKA: cAMP generated by adenylyl cyclase activates PKA, which then phosphorylates numerous downstream targets such as ion channels, other enzymes, and transcription factors . Beta-arrestins: Activation of the ADRB-1 receptor can lead to the recruitment of Beta-arrestins, which are used to activate signaling pathways independent of G-proteins. An example of an independent pathway is the MAPK (mitogen-activated protein kinase) pathways. Calcium signaling: ADRB-1 signaling also activates the Gq/11 family of G proteins, which is a subfamily of heterotrimeric G proteins that activates phospholipase C (PLC). PLC cleaves phosphatidylinositol 4,5-bisphosphate (PIP2) into the second messengers inositol 1,4,5-triphosphate (IP3) and diacylglycerol (DAG). IP3 binds to IP3 receptors on the endoplasmic reticulum, which then leads to the release of calcium ions (Ca2+) into the cytoplasm, resulting in the activation of downstream signaling pathways.
The FMO method is implemented in GAMESS (US), ABINIT-MP, PAICS, and OpenFMO software packages, distributed free of charge. Fu, is a general open-source GUI that can generate input files for FMO. Another graphical user interface Facio developed by M. Suenaga has a very convenient specialised support of FMO (in addition to other features), with which an automatic fragmentation of molecular clusters, proteins, nucleotides, saccharides and any combination thereof (e.g., DNA and protein complexes in explicit solvent) can be done in a few minutes, and a manual fragmentation of solids and surfaces can be accomplished by clicking the bonds to be detached. Facio can also visualise results of FMO calculations, such as the pair interactions. (E – energy, G – gradient, H – Hessian; bold – can be used with PCM) GAMESS (US)
Sources: en.wikipedia.org
System suitability is a set of checks that confirm the instrument and method perform within limits before sample analysis. It typically includes resolution, tailing factor, retention time, and peak area reproducibility. If a check fails, the run is invalidated until the cause is resolved.
QC samples are usually injected at the beginning, at intervals during the run, and at the end. The exact frequency depends on the method, sample count, and regulatory requirements. Results outside acceptance limits can require rejection of the affected samples and investigation.
Method validation demonstrates that an HPLC procedure produces reliable results for its intended purpose. It provides documented evidence for accuracy, precision, specificity, and other performance characteristics. Regulators and quality systems require validation before a method is used for release or stability testing.
System suitability is a set of checks performed before and during an HPLC run to confirm that the instrument and method are working as expected. It may include retention time repeatability, resolution between peaks, peak symmetry, and signal intensity. Failing suitability criteria usually invalidates the run.